PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG031566.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 255aa    MW: 28975.8 Da    PI: 9.3492
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG031566.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.6e-52141381128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+evd++k++PwdLp      e+e yfFs+r+ ky++g+r+nrat sgyWkatg dk+++++ ++
  CCG031566.1  14 LPPGFRFHPTDEELVVQYLKRKVFACPLPA-SIIPEVDVCKSDPWDLPGD---LEQERYFFSTREAKYPNGNRSNRATGSGYWKATGIDKQIVTSkGN 107
                  79****************************.89***************54...46799*********************************9988577 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kktLvfy+g+ p+g++tdW+mheyrl
  CCG031566.1 108 QAVGMKKTLVFYRGKPPHGTRTDWIMHEYRL 138
                  78***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-6010174IPR003441NAC domain
PROSITE profilePS5100557.69414174IPR003441NAC domain
PfamPF023652.1E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEKLNFVKNG AVRLPPGFRF HPTDEELVVQ YLKRKVFACP LPASIIPEVD VCKSDPWDLP  60
GDLEQERYFF STREAKYPNG NRSNRATGSG YWKATGIDKQ IVTSKGNQAV GMKKTLVFYR  120
GKPPHGTRTD WIMHEYRLAS TETAACNALL NKNSIQGSVV VPMENWVLCR IFLKKRSTKN  180
EEENMQFGND NRLSKLRTTK PVFYDFMTKH RTTDLNLAPS SSSGSSGITE VSCNESDDHE  240
ESSSCNSFPY FRRKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-511217915170NAC domain-containing protein 19
4dul_A1e-511217915170NAC domain-containing protein 19
1ut7_B1e-511217915170NO APICAL MERISTEM PROTEIN
1ut7_A1e-511217915170NO APICAL MERISTEM PROTEIN
1ut4_B1e-511217915170NO APICAL MERISTEM PROTEIN
1ut4_A1e-511217915170NO APICAL MERISTEM PROTEIN
3swp_D2e-511217918173NAC domain-containing protein 19
3swp_C2e-511217918173NAC domain-containing protein 19
3swp_B2e-511217918173NAC domain-containing protein 19
3swp_A2e-511217918173NAC domain-containing protein 19
3swm_D2e-511217918173NAC domain-containing protein 19
3swm_C2e-511217918173NAC domain-containing protein 19
3swm_B2e-511217918173NAC domain-containing protein 19
3swm_A2e-511217918173NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7700120.0KP770012.1 Populus tomentosa apical meristem (NAM) family protein (Potri.001G061200) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011020822.10.0PREDICTED: NAC transcription factor ONAC010-like
SwissprotQ9FY931e-108NAC83_ARATH; NAC domain-containing protein 83
TrEMBLB9GZC30.0B9GZC3_POPTR; No apical meristem family protein
STRINGPOPTR_0003s16490.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-108NAC domain containing protein 83